PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004489898.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family M-type_MADS
Protein Properties Length: 418aa    MW: 47846.5 Da    PI: 5.3519
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004489898.2genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF27.25e-0971116146
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
          SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46 
                     k i+n+  r++tf +R++g+  K +  S+  +a++++i++  +g++
  XP_004489898.2  71 KYINNEKVRKITFMNRKKGLTNKVSDFSTKSGAKACLIMYDGDGNV 116
                     5799************************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006614.24163123IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-963122IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-1563138IPR002100Transcription factor, MADS-box
CDDcd002662.32E-1464136No hitNo description
PfamPF003192.5E-1073116IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MATVLLEFVA AFAATKGNGY KRLWRPGRPQ MATSLWDFVV AWAATNGNVT LGFCGGLCSH  60
KRMGRAKVAI KYINNEKVRK ITFMNRKKGL TNKVSDFSTK SGAKACLIMY DGDGNVAPTI  120
WPENPTLVNS MLQEYENQKI EASPKIFDIK NYFKIKKEIV EAEILKVKKA ILRNKFPTWD  180
PSFNNMQVEH LTAFMEAINA KVQDCNERIN MMKNIQEIET NFLHNTSHMQ NMVPESLDSS  240
NSSQINVIQS IPQMEQYIHD PMELPLDDVY EMVNFTNHVD LPPNSSTNQL CQLVECDNLE  300
VKPINVCQLV ECDDLEVKPI NERGNQFADV DDWTNQLDDD IWNWIRQPDQ FSWNDISFLP  360
PSEHESAMGS RGRDDKIIRV TCDADTFTSS MMNPPKMIQP TTSRKKRRMI IEDDDKGE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004489898.20.0PREDICTED: uncharacterized protein LOC101495285
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.14e-18M-type_MADS family protein